RBP4 His Tag Protein, Human
SKU: 12772610038

RBP4 His Tag Protein, Human

Sale price$144.00 Regular price$160.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RBP4 His Tag Protein, HumanProduct Specification Species Human Synonyms Retinol Binding Protein 4; Plasma Retinol Binding Protein; PRBP; RBP; RBP4 Accession P02753 Amino Acid Sequence ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH Expression System HEK293 Molecular Weight 23 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions

Product Specification


Species Human
Synonyms Retinol-Binding Protein 4; Plasma Retinol-Binding Protein; PRBP; RBP; RBP4
Accession P02753
Amino Acid Sequence ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLHHHHHH
Expression System HEK293
Molecular Weight 23 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 50mM Tris-Hac,10mM CaCl,150mM NaCl, pH7.5
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Retinol binding protein 4, plasma, also known as RBP4, belongs to the lipocalin family and is the specific carrier for retinol(vitamin A alcohol) in the blood. It is protein that in humans is encoded by the RBP4 gene. RBP4 gene resides just centromeric of the cluster of CYP2C genes on 10q24. The mouse Rbp4 locus is closely linked and just proximal to the locus for phenobarbital-inducible cytochrome P450-2c(Cyp-2c) at the distal end of chromosome 19. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. The standard used in this kit is recombinant protein, with E19-L201 aa sequence, the molecular weight is 22kda.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12772610038

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1030 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
K. Torrance
Waukegan, US
★★★★★ 1
Cheap, screw holes don't line up, screen is to short, and bars take WD-40 and a mallet
This has been my worst purchase on Amazon ever. DO NOT BUY. My first issue was that bars #4 and #5 would not go together, I ended up buying WD-40 and a mallet and that kind of got them together. Now I went to but the screen on (which is almost see thought) and the screen is to short. I can't attached the bottom bar to the tall bar. The screw hole is in the wrong spot, so the screen is not secure. No amount of pulling on the screen will make it grown .25" longer. Since I can't get the bars secure the walls are not steady and fall over easily. The feet did go together very nice. I can't return them according to Amazons policy. I bought 2 sets. I'm not going to try to build the other set I have. And I can't take apart the first set, since the bars are so tightly together. Also the polls have rust on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2023
R
Verified Purchase
Rick
Natrona Heights, US
★★★★★ 3
Very Poor Built Quality
Color: Black, Size: 3-Panel
They use cheap tarp like cloth that you might find on a tent, so it is not suitable as a teleconferencing background without blur applied. The legs are flimsy and lack rubber feet, so it will scratch floors. The tubing is flimsy and very hard to move and adjust. This is only good if you are setting it up somewhere like a gym or a garage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2025
M
Verified Purchase
Mamacita
Lexington, US
★★★★★ 5
Great separator for room.
My kids love it. It separates their half of the room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2025
G
Verified Purchase
Gwendolyn
Waukegan, US
★★★★★ 5
These are PERFECT for my Art Show coming up!
This is going to be PERFECT for my Art Show display. And also....EASY to put up and take down as well as store. I'm so grateful to have found them! They are super light weight. And sturdy for my application. And elegant and have clean lines for my display. I have ivy draped and also fairy lights which make it look classy yet simple! Love them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2022
A
Amazon Customer
West Palm Beach, US
★★★★★ 5
Versatile Room Divider With Easy Assembly and Strong Coverage
Size: 3 Panel 12FT W
I picked up this Siebwin 3-panel folding room divider mainly for privacy and room separation, and overall it works very well. Assembly is very straightforward, and the divider can be set up, taken apart, and stored without much effort. The fabric quality feels good, and the frame construction is stronger and more stable than expected. The support tubes especially feel well built and help keep the divider standing securely. One feature I really liked is the flexibility of the design. The panels can be used together as a complete divider or separated depending on the setup and available space. That makes it much more versatile for different room layouts or temporary privacy needs. The coverage is also very good, and the size matches the manufacturer’s description accurately. The fabric blocks light and background visibility well enough to provide solid privacy without feeling overly heavy. The wider feet also help improve stability compared to thinner folding dividers. Another positive detail is that everything arrived complete with no missing parts or damaged pieces, which made assembly much easier and faster. Compared to cheaper privacy screens, this one feels more durable and easier to customize depending on the situation. In terms of value for the money, it feels like a very practical and worthwhile purchase considering the size, flexibility, and build quality. Overall, a versatile and well-built room divider with easy assembly, strong privacy coverage, stable construction, complete included parts, flexible panel configuration, and excellent everyday functionality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products