Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
BCMA/TNFRSF17 His Tag Protein, MouseProduct Specification Species Mouse Synonyms TNFRSF17, CD269, BCM Accession O88472 1 Amino Acid Sequence Met1 Thr49, with C terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 12 17kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at 0. 1 1 mg ml
Product Specification
| Species | Mouse |
| Synonyms | TNFRSF17, CD269, BCM |
| Accession | O88472-1 |
| Amino Acid Sequence | Met1-Thr49, with C-terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 12-17kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Gene ID: 608, updated on 18-Aug-2023. |
Background
B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. TNFRSF17 is expressed in mature B-cells, but not in T-cells or monocytes. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy