Human IL-12 p70, His tag
SKU: 27412412707

Human IL-12 p70, His tag

Sale price$222.75 Regular price$247.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12 p70, His tagProduct Specification Species Human Synonyms Programmed cell death 1, CD279, Programmed death receptor 1 Accession P29459,P29460 Amino Acid Sequence Protein sequence (P29459+P29460, Arg23 Ser219+Ile23 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms Programmed cell death-1, CD279, Programmed death receptor 1
Accession P29459,P29460
Amino Acid Sequence

Protein sequence (P29459+P29460, Arg23-Ser219+Ile23-Ser328, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS+IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 60kDa Actual: 70kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Interleukin 12 (IL-12) is an interleukin that is naturally produced by dendritic cells, macrophages, neutrophils, and human B-lymphoblastoid cells (NC-37) in response to antigenic stimulation. IL-12 belongs to the family of interleukin-12. IL-12 family is unique in comprising the only heterodimeric cytokines, which includes IL-12, IL-23, IL-27 and IL-35. Despite sharing many structural features and molecular partners, they mediate surprisingly diverse functional effects. IL-12 is involved in the differentiation of naive T cells into Th1 cells and plays an important role in the activities of natural killer cells and T lymphocytes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27412412707

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1651 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Keri
Massapequa, US
★★★★★ 5
Best makeup sponge
I use compact powder. Makeup goes on smooth and the sponge picks up enough product to give great coverage without multiple applications.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
A
Verified Purchase
Asia
New York, US
★★★★★ 5
Absolutely amazing! Must try.
I absolutely love this sponge!, it is so dense; it uses such a small amount of makeup but applies like a full coverage. I am using much less of my mineral makeup powder thanks to this sponge; plus it is easy to wash and dries quickly. Totally worth a try!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2024
F
Verified Purchase
35 F glitter loving unicorn
Lowell, US
★★★★★ 4
*update* Maybe(?) Perfect for those who hate eggs
Edit: Update It is with a heavy heart Im updating this review. When I said this sponge stains, I mean it really stains. Now to be fair it is marketed as a powder sponge and I use it with liquid so this my be entirely on the user (aka me) but it's like I can never get it clean. Between my repeated washing and the overall product build up the performance of this sponge went downhill quickly. The finish of my makeup suffered and the flocking took a beating. For what it's worth the sponge has not fallen apart and is still in one piece. But I get more of a 4 star finish than a 5 star finish. I've ended up using a large fluffy brush to buff out my foundation to get the desired result. I also ended up repurchasing the flocked flat ended egg from RT to replace this although at the moment I am still stubbornly using this sponge (and also avoiding doing my makeup) I do believe a lot of my issues are do to using this sponge with liquid foundation instead of power and that is on me. I'm finding it so very difficult to clean and the RT flocked egg cleans up so much easier. I don't hate this sponge but my lovefest has definitely taken a turn to more of a likefest. I am going to keep using (because I am stubborn like that) and see how long it takes to turn this relationship into a hatefest or fall apart completely, whichever happens first. I will most likely update again at that time. At this moment I am changing my review from 5 star to 4 star. I will be keeping my original review below. *original review* Yo I LOVE this thing. Ok here's the deal, I don't like the beauty blender, in fact I kinda hate it. Yea, I said it, I'm not on board with bouncing an egg all over my face, I think it's tedious and inefficient. I had at one time a flat teardrop shaped sponge that was my hands down favorite application tool for foundation. I used that thing until it literally fell apart. I tried to find a replacement but the store I had originally gotten it from no longer carried it so I kept using that ratty old sponge until it was missing chunks. I tried some other flat sponges but none worked as I wanted so I went back to brushes but I really hate cleaning foundation from brushes so I was pretty much hating my life. Then I found a flocked egg. Now I'm not a fan of the eggs but I was intrigued by the flocked texture and it had a nice flat edge so I tried it and it was almost as good as my old dearly missed flat teardrop sponge. I still was not a fan of bouncing an egg around on my face but I used this until the flocking wore off (about 6 months) Well, I saw this listing for a flat flocked sponge and I pounced on it. I am so incredibly deliriously happy with this little sponge. I love that it's flat and not an egg. I love the flocking. I love how it fits in my hand. I love love the finish I get with my foundation. I love it. Like I need to order a dozen more so I never run out and I'm trying to break my hoarding tendencies but for this tool I want to hoard. So the bad... It does stain easily. I wet my sponge before use and give it a quick clean after use. My old flocked egg would clean right up but this has stained on the first use. I also don't know how long this will hold up so I hope to update at a later time about that. Overall I couldn't be happier with this sponge.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2021
K
Verified Purchase
Kristyne
Lake Worth, US
★★★★★ 5
Perfect for liquid
This sponge is not made for liquid but I use it for my liquid foundation. The sponge won't last as long when it gets wet but it still lasts a LONG time! I put a drop of water on sponge first then dab a few times on my arm to dry with only a slight hint of moisture left (very dry feeling)... then add a drop of makeup (literally). The coverage is awesome and your makeup last 2 to 3x as long. Flawless finish. Love it! I recently updated my review...I still have same awesome sponge. Now I also mix a silicone air brush liquid (clear) to the liquid makeup it spreads farther and the finish is wonderful. Great product stays dry and drys very quick after use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2014
D
Verified Purchase
Doris
Carnegie, US
★★★★★ 5
Love this product!
I’ve used this product for a long time. It’s nice and soft and works well on my skin. I wouldn’t use anything else.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 29, 2024

recommand products