SerpinB3/SCCA Protein, Human
SKU: 3348961483

SerpinB3/SCCA Protein, Human

Sale price$99.00 Regular price$110.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SerpinB3/SCCA Protein, HumanProduct Specification Species Human Synonyms SerpinB3, SCCA1; Serpin B3, Protein T4 A, Squamous cell carcinoma antigen 1, SCCA 1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4 A,SCCA1 Accession P29508 Amino Acid Sequence

Product Specification


Species Human
Synonyms SerpinB3, SCCA1;Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A,SCCA1
Accession P29508
Amino Acid Sequence MHHHHHHDDDDKNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Expression System E.coli
Molecular Weight 45.9 kDa
Purity >90%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 150mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

SerpinB3/SCCA belongs to tumor-related glycoprotein antigen, also known as TA-4 antigen, which widely exists in the cytoplasm of uterine, cervical, lung and other squamous cell carcinoma, and has a high content in non-keratinized cancer cells, which is closely related to the occurrence and development of squamous cell carcinoma. In normal squamous epithelial cells, SerpinB3/SCCA inhibits apoptosis and participates in the differentiation of squamous epithelium, but participates in the physiological processes such as invasion, metastasis and recurrence of cancer cells in tumor cells. As a specific marker of squamous cell carcinoma, the concentration of SerpinB3/SCCA increases with the aggravation of the disease, and it is an important tumor marker reflecting the biological characteristics of squamous cell carcinoma. Its serum level is widely used in the diagnosis of squamous cell carcinoma of many organs and clinical evaluation of therapeutic effect.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3348961483

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1023 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom C
Los Angeles, US
★★★★★ 5
Excellent little grinder
For the price, this thing is a great value. I wanted to use it a bit before writing a review, because anything can be amazing initially. I have been using it for several weeks now and let me just say that for the price, you get a great little grinder. This thing isn't meant to grind up bags and bags of coffee, but for grinding a nice little bit for a few days at a time, it's perfect. It's easy to set the grind level / coarseness, and it "stays" where you put it. I have not had any issues and it seems pretty durable. I saw some complaints of it being slow, but maybe they just expected electric speeds with a manual grinder? Not sure, but for me I am able to grind a full reservoir (the container of this item) in less than a minute and a half, at best. I got this because sometimes I am lazy and didn't use the electric grinder the night before and I don't want to wake up the wife grinding my coffee, so this is PERFECT. The only thing is, now I don't use my electric grinder anymore.. The reason for that is I get more consistent ground coffee using this little guy than my electric grinder ever has. So now I am stuck in manual mode, and for cheap! This thing is super light and easy to store away, not bulky and won't get in your way. So if you are hesitant because you saw some bad reviews, just do what I did.. buy it anyway and find out for yourself. I have learned that most negative reviews on Amazon are because people expect things to be more than they are or to somehow function beyond their capabilities... This thing does what it's supposed to do, and it does it well. So buy one now, you won't regret it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
A
Verified Purchase
al kraml
Waukegan, US
★★★★★ 5
The right tool
Works great with peppercorns as well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
W
Verified Purchase
William R. Brown
Carnegie, US
★★★★★ 4
Gets it done.
At this price point it is a excellent grinder for coffee. It does adjust for different grinds but there is no scale to gauge, just clockwise or counter clockwise. Recommended if you are not sure if you want one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
G
Verified Purchase
Gabriel M.
Omaha, US
★★★★★ 5
It's get grinding! ;]
The coffee bean grinder is ease to use with mostly smooth consistency. It's regularly medium sized with mid noise precision. I suppose you can ideally take this puppy with you camping if you have some extra room in your cargo. All in all, it's consistently done it's job which is grinding them beansss!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
S
Verified Purchase
Sam B
Carnegie, US
★★★★★ 5
Simple grinder
Great alternative to more expensive grinders, adjustable, could be a bit easier to use but the price is very fair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products