Human CD90, hFc tag
SKU: 51327664609

Human CD90, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD90, hFc tagProduct Specification Species Human Synonyms CDw90, Thy 1 antigen Accession P04216 Amino Acid Sequence Protein sequence(P04216, Gln20 Cys130, with C hFc)

Product Specification


Species Human
Synonyms CDw90, Thy-1 antigen
Accession P04216
Amino Acid Sequence

Protein sequence(P04216, Gln20-Cys130, with C-hFc) QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:38.6 kDa Actual:54 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 led to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51327664609

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1874 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Wilda Sokol
Massapequa, US
★★★★★ 5
Great teaching on in depth Biblical scriptures.
Format: Paperback
There is nothing to dislike.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2022
A
Verified Purchase
Author C. Orville McLeish
Dallas, US
★★★★★ 5
Water for a Thirsty Soul
Format: Kindle
Dr. Ana's books are always such a pleasure to read. They are filled with divine knowledge and revelation and this book is no exception...it is like water for a thirsty soul. It gives a divine perspective to the spiritual reality that we have devalued so much in exchange for the comfort of a world we have built for our own comfort. This book offers a lot to process and it has left me wanting more...particularly in the area of connecting and living from our celestial body.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 1, 2021
J
Verified Purchase
Jessica L. Jensen
West Palm Beach, US
★★★★★ 5
Looks good works great
Item Package Quantity: 1, Color: Black
This paper towel holder is simple, sturdy, and works exactly as it should. It holds the roll securely and makes it easy to tear off sheets with one hand. The design is clean and attractive, so it looks great on the countertop without taking up too much space. No assemble required and a great value overall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
V
Verified Purchase
VFlorida
Carnegie, US
★★★★★ 5
Functional and beautiful!
Item Package Quantity: 1, Color: Silver
This towel holder is a fantastic find! It is always great when a product exceeds your expectations and this towel holder is exactly that. At first, I was not sure if the price was worth it but when I opened the box, I was pleasantly surprised by the quality of the product. It is solid and well made with a heavy base that makes pulling paper towels with one hand a breeze. The mandrel is thick and provides excellent rotational ability. Overall A+. I highly recommend spending a few extra bucks on a functional piece that enhances the overall appearance of a kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
L
Verified Purchase
Laura Maness
Lake Worth, US
★★★★★ 5
Looks good works great
Item Package Quantity: 1, Color: Silver
This is a nice paper towel holder. I keep it on my counter and it looks great. Its easy to use although I haven't tried it one handed. I like it and I think it was a good price. It was very heavy and works great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products