Human Collagen IV, His Tag
SKU: 57275905679

Human Collagen IV, His Tag

Sale price$99.00 Regular price$110.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Collagen IV, His TagProduct Specification Species Human Accession P02462 Amino Acid Sequence Protein sequence(P02462, Lys28 Lys172, with C 10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 28kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species Human
Accession P02462
Amino Acid Sequence Protein sequence(P02462, Lys28-Lys172, with C-10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 28kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Collagen typte IV is a type of collagen found primarily in the basal lamina. Mutations to the genes coding for collagen IV lead to Alport syndrome. This will cause thinning and splitting of the glomerular basement membrane. It will present as isolated hematuria, sensorineural hearing loss, and ocular disturbances and is passed on genetically, usually in an X-linked manner. Liver fibrosis and cirrhosis are associated with the deposition of collagen IV in the liver. Serum Collagen IV concentrations correlate with hepatic tissue levels of collagen IV in sugjects with alcoholic liver disease and hepatitis C and fall following successful therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57275905679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 605 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MAAC
New York, US
★★★★★ 5
💪🏼💪🏼🇺🇸🇺🇸🇺🇸
Color: Navy Blue
⭐️⭐️⭐️⭐️⭐️ Very high-quality product, ideal for all types of heavy-duty work. It feels strong, comfortable, and durable. It performs its function perfectly and exceeds expectations. I highly recommend it for its excellent performance and great value for the pr
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
L
Verified Purchase
Layla
Lake Worth, US
★★★★★ 5
Pink IPad Case
Color: Pink
Great case. My iPad feels very safe in this case compared to my other ones. Easy to clean and the color matches the picture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
R
Verified Purchase
R.
Lake Worth, US
★★★★★ 5
Great product
Color: Navy Blue
Awesome product. It does everything I need it to. Very smooth and stylish as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
K
Verified Purchase
Kindle Customer
Los Angeles, US
★★★★★ 4
keyboard and case is phenomenal, trackpad is borderline unfunctional
Color: Black
I bought this case, because of the keyboard and trackpad, i wanted to use my ipad more like a laptop. the keyboard is phenomenal and certaintly better than other cheap ipad keyboards i have tried, I can actually use this one without having to repeatedly slam or hard press certain keys and can actually have a flow of typing. additionally, everything else regarding the case itself is amazing. it isnt cumbersome or bulky and it is very easy to swap between ipad and laptop mode on the fly. the trackpad however is genuinely unusable. the sensitivity on the trackpad is horrid and I cannot figure out how to change it, and additionally, clicking using the trackpad is outright impossible. you try to left click, it registers as a right click, or you try to click and it instead snaps your cursor to the bottom of the screen instead. it is also impossible to use any gesture functions with the trackpad, even something as simple as scrolling up and down or left to right is impossible. it is outright impossible to have any kind of workflow using the trackpad. it is unfortunately just a lot easier to use the keyboard and touch screen! its a shame that the keyboard and case itself is very nice too, so I will now have to spend more money on a separate mouse, which is additionally ANOTHER item i will have to carry around, just to make what I already bought work the way I expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
J
Verified Purchase
Jessie A.
Fort Morgan, US
★★★★★ 5
Great quality at a great price range!
Color: Navy Blue
Works very well for the day to day. Great quality at a great price range. Would definitely buy again if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products