Human Haptoglobin, His tag
SKU: 81148194594

Human Haptoglobin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Haptoglobin, His tagProduct Specification Species Human Accession P00738 Amino Acid Sequence Protein sequence(P00738, Val19 Gln160&Ile162 Asn406, with C 10*His)

Product Specification


Species Human
Accession P00738
Amino Acid Sequence

Protein sequence(P00738, Val19-Gln160&Ile162-Asn406, with C-10*His)
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 44.8kDa Actual: 57-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Haptoglobin (abbreviated as Hp) is the protein that in humans is encoded by the HP gene. In blood plasma, haptoglobin binds with high affinity to free hemoglobin released from erythrocytes, and thereby inhibits its deleterious oxidative activity. Compared to Hp, hemopexin binds to free heme. The haptoglobin-hemoglobin complex will then be removed by the reticuloendothelial system (mostly the spleen).Haptoglobin is an acute-phase protein, its concentration in plasma changes in pathology, and the test for its concentration is part of normal clinical practice. Haptoglobin is a conservative protein synthesized mainly in the liver and lungs and is the subject of research as a potential biomarker of many diseases, including various forms of malignant neoplasms.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81148194594

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1554 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A. Stith
Whiting, US
★★★★★ 5
Nice product
Love the feel of the whipped cream ,and the face product does give you a nice shine . But it maybe a little too shiny at times . But I have only used it once .As I just received it .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
M
Verified Purchase
Marcia Acker-Missall
Natrona Heights, US
★★★★★ 4
Creamy moisturizer
Love this easy spreadable and creamy moisturizer Absorbs well especially after a shower and works best then. Pleasant aroma as well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
K
Verified Purchase
Kaya
Waukegan, US
★★★★★ 5
Will buy again!
This smells AMAZING. Immediately after I opened up the whipped lotion, I was hit with an intense coco butter smell. The oil has the same affect, only with a gorgeous shiny finish. Both the oil and the butters consistency is perfect, the lotion doesnt feel too thick and the oil doesnt leave me slipping and sliding lol. There is shimmer in it but it doesnt look like Ive covered myself in glitter so i love that. The moisture lasts for such a long time especially when applied right after a shower. My skin absorbed it very nicely without feeling sticky or like there is any left over residue. The price for two was absolutely worth it10/10 will reorder after I run out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
C
Verified Purchase
Capri Cheatham
New York, US
★★★★★ 5
Worth it
Love love love this product. I bought it for myself and my sister very nice feeling after a good shower. Smells good not too much for bed or for outside.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
B
Verified Purchase
Barbara W
Carnegie, US
★★★★★ 5
Worth it
Okay first night using and I’m in love. Smells amazing. I’m particular about my vanillas but this is light but strong. Doesn’t disappear right away sits on the skin nice and drifts on the air as a nice aroma. Dries down wonderfully too. I did have to use a few pumps to cover each part of my body but so worth it. It’s not greasy at all and gives a nice glow. Application was easy and I do feel moisturized. Looking for the lotion version now to layer over top it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products