SKU: 81495002018

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81495002018

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gracie Galvan
Grantham, US
★★★★★ 5
Hydrating and Powerful Barrier Repair Serum!💧
This serum has been life-changing in calming and restoring my skin barrier. It absorbs quickly, feels lightweight, and instantly soothes irritation without feeling greasy. I’ve noticed my skin looks healthier and more balanced after just a few uses. It’s gentle enough for sensitive skin and works especially well when my skin barrier feels compromised. It is also fragrance-free, which I always appreciate! Trust me, it’s well worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
O
Verified Purchase
Oc
Houston, US
★★★★★ 5
Works as created.
Have been using for a few weeks and have noticed 15% improvement in skin and issues. I did notice a difference in the first 24 hours as advertised. It is suggested need a full month I think to see the true results. At 50 I have pre menopausal skin issues- the redness & inflammation, acne, tightness and sensitivity. It is helping in addition to the other Avene skin products that come in the trial box for sensitive or SOS skin box trial size I think ot is called. This has made a difference. It is easy to apply. I use morning and night. It is different from the Cicalfate + Cream. I use that also as needed. I am happy and recommend it. The price is higher than what I spend. But I wanted to try it to see of i need more than just what was in the Avene sensitive skin trial size box they have. My skin is really red and irritated so the $40 for the bottle is was willing to try because it's painful on my face.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
T
Verified Purchase
Taylor Ashley
Waukegan, US
★★★★★ 4
Okay serum, not as good as the cream though
I am obsessed with the cream version of this so I thought I’d give this a try. The dropper top allows for easy application. The formula is light and non greasy and absorbs easily. No harsh fragrances. I would use it when I had eczema flares on my face and feel like it didn’t work near as well in helping with skin irritation as the cream does. As of now I don’t use it as part of my regular skin care. Do I think it’s a bad product? No, but it didn’t really work wonders for me. Not sure I would purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
E
Verified Purchase
Elizabeth from Houston
Boise, US
★★★★★ 5
Helps with redness and softens skin
I have sensitive, mild rosacea skin. Had a facial recently and the aesthetician suggested I get a serum to help with moisturizer as I am almost 40. I’ve tried a lot of serums and either they are sticky and not really hydrating or break my skin out in a rash. This serum is amazing. Helps calm the redness in my cheeks and my skin is moisturized and soft all day. It feels a little sticky at first but it goes away. I apply in this order OSEA sea mineral mist toner to prep the skin, this serum and top off with Chanel La Solution 10 for sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
C
Verified Purchase
carolyn
Belleville, US
★★★★★ 5
Sensitive skin
Such a good product. I use after micro needling when skin is sensitive. Also a great product to use as a barrier serum when starting tretinoin cream.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products