Human GP73, His tag
SKU: 93003400037

Human GP73, His tag

Sale price$218.25 Regular price$242.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GP73, His tagProduct Specification Species Human Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2 Accession Q8NBJ4 Amino Acid Sequence Protein sequence(Q8NBJ4, Arg55 Leu401, with C 10*His)

Product Specification


Species Human
Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2
Accession Q8NBJ4
Amino Acid Sequence

Protein sequence(Q8NBJ4, Arg55-Leu401, with C-10*His)
RAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 41kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Golgi protein-73 (GP73) is a type II Golgi-localized integral membrane protein that is normally expressed in epithelial cells of many human tissues. It is essential for human survival, and might have multiple roles for GP73 in epithelial cell function such as in the kidney and liver. GP73 has been suggested as a potential serum marker for the diagnosis of hepatocellular carcinoma (HCC),Several reports have stated that GP73 is a better marker than AFP for diagnos ing HCC. Many studies have demonstrated that significant increases of  non-viral causes (alcohol-induced liver dis ease, autoimmune hepatitis). Therefore, some researchers consider that an increase in GP73 expression is a common feature of hepatocyte response to a variety of disease etiologies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93003400037

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1273 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
❤️ 2read
Dallas, US
★★★★★ 3
Ali and the guys
Format: Kindle
The story of a lost art student that needs direction. Decides to nanny for a winery owner and his best friends/employees. Fires and lockdowns happen and relationships start. Lots of spice sometimes a little too much I found myself skimming over the parts. Happy ending
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
M
MS. SHAWN M. LINDSAY
Waukegan, US
★★★★★ 5
Artist Inspiration
Format: Kindle
Ali Fairfax is a twenty-seven year old painter. She is going to an interview for a job as a nanny. She wants to go to art college but has no portfolio pieces to submit. For the last year, her mind goes blank the second she picks up a brush. The nanny interview is at Ashford Winery. Luke Ashford has a son named Charlie who is almost five. Beckett Montgomery is one of Luke’s best friends and he helps Luke run the winery. Hunter Jones is Luke’s other best friend and he is the marketing director for the winery. The men have been running the winery for the last year or so. Charlie likes Ali and so does Luke, so he hires her. Charlie is into reptiles and he also makes Ali make a grilled cheese sandwich for his snack. Hunter comes in the kitchen to tell them that the winds have shifted and there are wildfires nearby. All the roads in or out of the valley are closed down for now. Ali is stuck at the winery with the men and Charlie. Interesting dynamic between the three best friends. I loved that being stuck at the winery inspired Ali to start painting again. I enjoyed the story. I received a free copy of this book via Booksprout and am voluntarily leaving a review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
J
Jenny Harris
San Leandro, US
★★★★★ 4
So So Good
Format: Kindle
I received this book with the understanding that I could leave a voluntary and honest review. In this book we meet Ali Firfax, Luke Ashford, Beckett Montgomery, & Hunter Jones. Ali is ready for a new adventure in her life. Though her mother worries about her she is determined to do her own thing. When she gets to the house though she can't believe how attractive all the men who live there are. Luke's first priority is defiantly his son, one look at Alit though has him wondering if he has been to narrow minded. When he two roommates realize who Ali is they will do anything they can to keep her there. When mother nature tends to help them they know they will do anything to keep her. Can they all find a HEA or will mother nature make sure none of them have a future? Amazing story by this author. I would highly recommend it to anyone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 13, 2025
M
M
Belleville, US
★★★★★ 5
Fire 4 ¾ stars
Format: Kindle
Set against the backdrop of California fires, this is a story of Ali finding her forever family. Luke, Becket and Hunter own a winery that is close to the fire. Every day is a wait and see if they are going to lose their home. Ali, an aspiring artist, applied to be the nanny to Luke’s son. The attraction was obvious from the very beginning. Once Ali decided to let go, the steamy scenes were unstoppable. I like that the author showed the readers not just the relationship between her and the guys. The story also showed how the three are close to each other. It’s a good bedtime read. I received an advanced copy and voluntarily chose to review it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2025
M
Mark Roberts
Grantham, US
★★★★★ 5
Great Read
Format: Kindle
The interview was perfect and the way she ran out thinking the worst is so something I would have done. When Luke goes out to get her and asks her to stay is even better. The way Beckett acts is the complete opposite of Luke and Hunter. They all have different personalities but they each pull something different from her. They way they work as a team to save everything was just part of what shows what a future could look like for them. I would love to read more. I received a free copy of this book via Booksprout and am voluntarily leaving a review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2025

recommand products