Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP3 His Tag, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4
Product Specification
| Species | Human |
| Accession | P05413 |
| Amino Acid Sequence | MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
| Expression System | E.coli |
| Molecular Weight | 15.7 kDa(Reducing) |
| Purity | ＞95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy