ASFV p54, His tag
SKU: 15423015031

ASFV p54, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ASFV p54, His tagProduct Specification Species African Swine Fever Synonyms pE183L Accession Q65194 Amino Acid Sequence Protein sequence(Q65194 Ser54 Leu183, with C 10*His) SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 15. 5kDa Actual: 20kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species African Swine Fever
Synonyms pE183L
Accession Q65194
Amino Acid Sequence

Protein sequence(Q65194 Ser54-Leu183, with C-10*His)
SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:15.5kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

African swine fever (ASF) is a highly lethal hemorrhagic viral disease of swine that usually results to a mortality rate approaching 100% in domestic pigs and is classified as a notifiable disease by the World Organization for Animal Health (OIE). A number of studies have reported that p54 is one of the most important ASFV proteins and plays a key role in virus morphogenesis and viral infection. Anti-p54 sera were found to inhibit ASFV attachment to susceptible cells, suggesting its role in virus entry. Similarly, p54/E183L gene plays an essential role in virus viability and recruitment of envelop precursors to assembly sites. Most importantly, E183L gene is crucial for virus particle transporting to perinuclear factory via direct binding to light chain 8 (LC8) of the dynein. A short p54 peptide (149–161 aa) near to its C-terminus is enough to bind to dynein light chain 8 (DLC8) and act as a cargo transport for virus particle.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15423015031

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 253 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mystery_Machine_Gang
Bozeman, US
★★★★★ 4
This was more than I expected...
Format: Kindle
So...I finished this book at nearly 2am! It was just that hard to put down. I loved that it's set in the same world as Fates Hollow but in the future. Poor Pandora has been through so much but there's light at the end of the tunnel for her. She finally meets her dad and it turns out he's amazing. In order to help her learn about demon society and how to control her magic he sends her to the Demon Reform Academy. There she meets 2 awesome demons who help her and care for her. She also sadly meets her 3 tormentors. I will say though that while they do bully Pandora they also rescue her several times and defend her. They too have traumatizing pasts and can't see the good that is in front of them. Of course demon society needs to be shaken up too since that's part of the problem. I really enjoyed this read. I teared up a few times throughout the book but I liked the characters and that ending...well it looks like 3 in denial are going to need to grovel hard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2024
K
Verified Purchase
Krystle
Natrona Heights, US
★★★★★ 5
MUST READ BOOK!!
Format: Kindle
I was in a huge reading slump, when one of my favorite authors recommended this book in her readers group (The amazing Marie Mistry 🫶) and I absolutely DEVOURED this book. Now I’m in the club crying about having to wait until December for Term 2! This book is about a girl named Pandora who has suffered a life that nobody would ever wish to have. This book is about Pandora learning how to live, learning about herself and what she really wants. She has a long journey to find out all of these things, but she took the first steps in this book and it was beautiful to read. Some of the men in this book are our dream men, Hunter and Reed 😍 and then we have the men who need some work and who we all really just want to beat up until they admit what they really feel, Skel, Bram and Dexter. But that cliffy was a killer and I absolutely cannot wait until the next book!! You have written an absolute dream of a book Lyra and I eagerly await the next installment in this series!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2024
R
Verified Purchase
RavenousRaven
West Palm Beach, US
★★★★★ 5
One of the best reading experiences I’ve ever had
Format: Audiobook
This was truly AMAZING!!!!!!!!!!!! In every possible way. - the setting. I loved the steampunk/gaslamp setting with trains, overcast weather, and mafia vibes - the magic. I still don’t entirely understand the magic system and descendants as much and it took awhile for me to get my footing in that department- and I am intrigued beyond measure, though it in no way lessened my enjoyment of the story. I just really wish I had a better grasp of it. - the plot itself. Beautiful. The tropes were troping in the absolute best way. Every single thing that happened I was like YES MORE!!! - the writing. I found myself grinning ear to ear uncontrollably during my entire read through and full on choking on my gasps, again, like the entire read through. And I read this too at times when I was in an awful mood so the way this book was an INSTANT pick me up really speaks to how well this was written. I was having the absolute best time, non stop. - the characters. The best part oh my gosh. Camilla is SUCH a badass. Her and Nico are supposed to be low 20s and I gotta tell you they read more like 30s from how capable and mature they are (not that that age bracket is incapable or immature, just comparing them to other characters written in that age range). She is the type of cool as heck character that everyone would be cos-playing as and if it was a kid movie, every single girl would dress as her for Halloween. She’s that awesome. Nico is top freaking tier. I gotta say his hairstyle is my undoing and with the addition of the metal arm- before I even started reading the book I was in love with him. And he was EVEN BETTER than my lofty expectations. This man. Perfect in every single way. Every. Single. Way. If I start now I won’t stop so I’m just gonna leave it at that. Camilla and Nico are power couple of the century though and the way they interacted was the most toe-curling/squealing/kicking your feet banter I’ve read in a while. PLUS the way they fell for each other was a gem. I was falling in love with their relationship right along with them. - a shout out to the side characters too. Aramis, Gideon, Aunt Fran, Esme, Luther, Adler [honestly just insert all the supporting cast they were freaking phenomenal] brought so much life and personality to the story and helped round out Nico and Camilla. I really really really would absolutely adore if Adler got some more spotlight time in the future because he and Aramis are up there with “let’s give these side characters their own spinoffs”. Also, the villains were great too. I love a great villain in a story and sometimes I don’t think they get highlighted as much in books as in movies or TV that I hear of. If it wasn’t obvious already- this was even greater than a 5 star read. This was perfection- in quality and in vibes- and it was one of the most enjoyable reading experiences I have ever had and I’m not throwing that around lightly. I have scenes from this book playing in my mind unbidden on repeat and I know this world has so much more to be explored. I will read anything Alexis L Menard puts out in the future
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
J
Verified Purchase
Jenny
Houston, US
★★★★★ 4
Great mix of maffia and magic
Format: Kindle
This one felt really unique to me, with a great and successful blend of Twenties-feeling maffia and inventive magic. I liked both the main characters a lot, even though I found myself almost shouting at the MFC sometimes. She really should learn not to trust everyone just because they're family! All in all a good read, with lots of romance, yearning and some spice as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
M
Verified Purchase
Meghan
Cuba, US
★★★★★ 3
So close to being good
I really wanted to like this book. It had all the makings of a strong, interesting story, but the plot got so convoluted that it was hard to follow. Also, for a "badass" FMC, Milla was amazingly inept. The writing got really stilted at times too. I will probably still read the next one anyway, because I'm curious to see where the plot goes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2024

recommand products