Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD63, His tagProduct Specification Species Human Synonyms Granulophysin, Lysosomal associated membrane protein 3 (LAMP 3), Lysosome integral membrane protein 1 (Limp1), Melanoma associated antigen ME491, OMA81H Accession P08962 Amino Acid Sequence Protein sequence(P08962, Ala103 Val203, with C 10*His) AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight
Product Specification
| Species | Human |
| Synonyms | Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H |
| Accession | P08962 |
| Amino Acid Sequence | Protein sequence(P08962, Ala103-Val203, with C-10*His) |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 13.2kDa Actual:17-30kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
|
Background
CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 2389 reviews
Sort
Product Reviews
★★★★★ 3
Good book if you are just getting started with the metaphysical.
Format: Kindle
I was excited to offer a review of this book in exchange for a copy. I have been interested in this topic but had yet to read up on it. It is an easy reading book and provides a good understanding of astral projection and provides steps to start exploring it. It is definitely a beginners book not just a beginners of astral projection. My reasoning for the three stars is the writing in the book goes from an instructional format to a humorous format and back again. The writing format is very inconsistent. There is also quite a bit of discussion around the legitimacy of metaphysical beliefs and other pieces that do not directly relate to astral projection but are necessary pieces to develop the confidence to astral project. Overall, I would recommend this book if you are interested in the topic but have not yet started to dig into other metaphysical topics.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2021
★★★★★ 5
much more in depth information on the subject
Format: Kindle
Better than other books I’ve read on astral travel. Definitely more detailed and varied methods to leave your body. Thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
★★★★★ 5
Beautiful Unique Cookbook
Format: Hardcover, Format: Hardcover
This cookbook is filled with beautiful recipes, photographs and unique techniques to presenting your bakes. I don’t find the techniques outlined in the book to be at all intimidating, I can’t wait to jump in. With that being said, if decorating/food presentation is not your style then you can just keep it for the lovely macaron, cake and cookie recipes! I’m convinced though, if you can make a successful macaron then you can sponge paint on a cookie or dye a macaron red and throw some seeds on it. Give it a try at least!!
The packaging was also very secure, it came shrink wrapped with a cardboard back so it arrived in perfect condition. I will update the review with more pictures once I have completed some bakes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2018
★★★★★ 5
Gorgeous pictures, tasty treats!
Format: Hardcover
I first got this book out of our library and knew I wanted my own copy the second I opened it! The photography is gorgeous and makes me want to try every single thing! Beautiful colors and flavors and incredible looking bakes that are all very doable. Great instructions as well with temperatures in both F and C for wherever you're baking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2021
★★★★★ 5
Drool, baby, drool
Format: Hardcover
Not only has great photography, but inspiring photos. I love books like this. They make me feel like I can also achieve what they’ve presented in the recipes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2025
recommand products
EBC S11 Kits Greenstuff 2000 and RK Rotors (S11KR1106)
122.97
EBC S12 Kits Redstuff and RK Rotors (S12KF1132)
214.18
EBC S11 Kits Greenstuff 2000 and RK Rotors (S11KR1031)
191.54
EBC S12 Kits Redstuff and RK Rotors (S12KF1073)
217.99
Side Door Pocket Cup Holder Inserts Fits 2016-2023 Toyota Tacoma
49.99