Human CD63, His tag
SKU: 20351439222

Human CD63, His tag

Sale price$173.25 Regular price$192.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD63, His tagProduct Specification Species Human Synonyms Granulophysin, Lysosomal associated membrane protein 3 (LAMP 3), Lysosome integral membrane protein 1 (Limp1), Melanoma associated antigen ME491, OMA81H Accession P08962 Amino Acid Sequence Protein sequence(P08962, Ala103 Val203, with C 10*His) AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight

Product Specification


Species Human
Synonyms Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H
Accession P08962
Amino Acid Sequence

Protein sequence(P08962, Ala103-Val203, with C-10*His)
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13.2kDa Actual:17-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20351439222

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 2389 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Lisa Stelick
Boise, US
★★★★★ 3
Good book if you are just getting started with the metaphysical.
Format: Kindle
I was excited to offer a review of this book in exchange for a copy. I have been interested in this topic but had yet to read up on it. It is an easy reading book and provides a good understanding of astral projection and provides steps to start exploring it. It is definitely a beginners book not just a beginners of astral projection. My reasoning for the three stars is the writing in the book goes from an instructional format to a humorous format and back again. The writing format is very inconsistent. There is also quite a bit of discussion around the legitimacy of metaphysical beliefs and other pieces that do not directly relate to astral projection but are necessary pieces to develop the confidence to astral project. Overall, I would recommend this book if you are interested in the topic but have not yet started to dig into other metaphysical topics.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2021
R
Rachel
Waukegan, US
★★★★★ 5
much more in depth information on the subject
Format: Kindle
Better than other books I’ve read on astral travel. Definitely more detailed and varied methods to leave your body. Thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
L
Verified Purchase
Lucia
Chelsea, US
★★★★★ 5
Beautiful Unique Cookbook
Format: Hardcover, Format: Hardcover
This cookbook is filled with beautiful recipes, photographs and unique techniques to presenting your bakes. I don’t find the techniques outlined in the book to be at all intimidating, I can’t wait to jump in. With that being said, if decorating/food presentation is not your style then you can just keep it for the lovely macaron, cake and cookie recipes! I’m convinced though, if you can make a successful macaron then you can sponge paint on a cookie or dye a macaron red and throw some seeds on it. Give it a try at least!! The packaging was also very secure, it came shrink wrapped with a cardboard back so it arrived in perfect condition. I will update the review with more pictures once I have completed some bakes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2018
I
Verified Purchase
Illinikayaker
Draper, US
★★★★★ 5
Gorgeous pictures, tasty treats!
Format: Hardcover
I first got this book out of our library and knew I wanted my own copy the second I opened it! The photography is gorgeous and makes me want to try every single thing! Beautiful colors and flavors and incredible looking bakes that are all very doable. Great instructions as well with temperatures in both F and C for wherever you're baking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2021
S
Verified Purchase
S. Johnson
Phoenix, US
★★★★★ 5
Drool, baby, drool
Format: Hardcover
Not only has great photography, but inspiring photos. I love books like this. They make me feel like I can also achieve what they’ve presented in the recipes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2025

recommand products