Human PRL, His tag
SKU: 32920842045

Human PRL, His tag

Sale price$173.25 Regular price$192.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRL, His tagProduct Specification Species Human Synonyms Prolactin, Lactotropin Accession P01236 Amino Acid Sequence Protein sequence(P01236, Leu29 Cys227, with C 10*His) LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 24. 5kDa Actual: 25,28kDa

Product Specification


Species Human
Synonyms Prolactin, Lactotropin
Accession P01236
Amino Acid Sequence

Protein sequence(P01236, Leu29-Cys227, with C-10*His)
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 24.5kDa Actual:25,28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events. Prolactin plays an essential role in metabolism, regulation of the immune system and pancreatic development. Prolactin levels may be checked as part of a sex hormone workup, as elevated prolactin secretion can suppress the secretion of follicle stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and sometimes causing erectile dysfunction. Prolactin levels may be of some use in distinguishing epileptic seizures from psychogenic non-epileptic seizures. The serum prolactin level usually rises following an epileptic seizure.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32920842045

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 789 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Atherney Family Farm
Charlottesville, US
★★★★★ 5
Nice elegant suit for any occasion.
Color: Light Blue, Size: 12, Color: Light Blue, Size: 12
The suit set is very nice, the fabric material is durable and soft. Overall stitching is tight with nice surging of the hems and great construction on the shoulders. Buttons and button wholes are well done. I'm going to iron in the creases on the front of the pants because they weren't folded properly for shipping. The material does hold on to wrinkles so don't be afraid of your iron to get a super sharp look. The color is a soft baby blue that stands out in a crowd of black suits. With the option of an elastic tie or clip on bowtie this is everything you need to make him look presentable for a variety of occasions. My only complaint about this suit kit is the dress shirt is stiff and thin. I found some loose threads that I don't trust to not get played with. I'll probably trade it out for something with a little more cotton. As far as cost goes mid range, but definitely worth the cost. I might consider something with a vest if it's a super formal event, but I'm very happy with how this suit comes together.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
M
Martin V.
Omaha, US
★★★★★ 5
Modern luxury with summer fabric that performs above its price!
Color: Beige, Size: 14, Color: Beige, Size: 14
Wow! My son wore it for Easter Sunday and this suit fits the bill! The linen material is spot on--not too heavy and not too light especially since the weather is warming up now. The jacket is quality made--the design is modern executive, the stitches are strong no flaws to note. The pants are tad bit longer but that's okay, build quality is also great. The white shirt is decent and matches well with the rest of the set. The bow tie and tie itself is a great complimentary to the set, though optional to wear. The whole set just has that quality you would really look for in the price range you would want to pay. Overall, best value for for the, wear right outside the bag, maybe a light ironing otherwise it's perfect! I highly recommend it, no complaints here very happy with this suit!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
A
Ariel B.
Bozeman, US
★★★★★ 4
Heavy linen character, but a beautifully tailored suit!
Color: Beige, Size: 4, Color: Beige, Size: 4
This is a really nice linen suit! The jacket is beautifully made and well-tailored, with a fun speckled texture that has lots of pretty color variation (we ordered the beige). When I placed it side by side with a similar linen suit from another brand, the difference in the linen texture was really noticeable — this had a much stronger linen character that stands out! It has three useful pockets on the outside of the jacket, which is great for little hands. The only downside is that one of the inside pockets is just for show (faux), which was a bit surprising and somewhat disappointing for my little guy. The pants have pockets too, but they aren’t very deep — perfect for small treasures, but not much more. The pants are made from a lighter, thinner single-layer linen compared to the fully lined, double-layer jacket, which makes sense for comfort and easy movement. The pants didn’t come with a front crease ironed in, so you’ll want to press one yourself. The linen did pick up some creases from being folded in the package, but it doesn’t seem quite as wrinkly as some other linen fabrics I’ve tried. Still, like most linen clothes, especially for boys, the pants will need occasional ironing to keep them looking neat and crisp, especially after a day of play and general wear. The structured, lined jacket stays looking smoother and more put-together with less effort. It also came with a bow tie, a neck tie, and a tuxedo-style white shirt as extras. The ties aren’t great quality — they’d work fine for quick photos but probably won’t hold up to much actual wear. The formal white shirt feels a bit funny paired with the casual linen suit, but I don’t mind at all. We already have white shirts that we prefer, so we’ll use those instead. For us, the extras are really just bonus items we won’t plan on using. Overall, it’s a handsome little suit that’s perfect for special occasions like weddings, family photos, or holiday events. My kid looked adorable in it! The stronger linen texture on the jacket gives it a premium feel that I really like. Just be ready for a bit of extra care with the pants to keep everything sharp.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
C
chzgr8er
Houston, US
★★★★★ 5
Great suit set
Color: Light Grey, Size: 4
It is incredibly attractive and includes everything a young child needs for a special occasion. The material is a 75% polyester and 25% linen blend, and the outer fabric feels remarkably smooth. Its unstructured design allows for an attractive, natural drape, and the blend conveniently allows for machine washing at home. As is typical with linen-based materials, the fabric can be naturally stiff and prone to wrinkling, so I recommend ironing or steaming it before use. The lightweight feel makes it an excellent choice for the spring, summer, and fall months. Overall, this suit offers exceptional value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Summer wedding kids suit
Color: Navy, Size: 10 Years, Color: Navy, Size: 10 Years
Bought this suit for my son in the 10 youth size and honestly was pleasantly surprised by the quality for the price. The navy color looks sharp and dressy without being too stiff or uncomfortable. The material has a little stretch, which helped it fit nicely and made it comfortable for him to move around in. The adjustable waist was a huge plus, especially for growing kids. It fit true to size overall, though the blazer sleeves were slightly long on my son. The pants had a nice slim look without being too tight. We paired it with white sneakers for a more modern look and it came out adorable. This would be perfect for weddings, graduations, concerts, communion, school events, or family photos. Overall, very happy with the purchase and would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products