SKU: 23338618759

Parvalbumin His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Parvalbumin His Tag Protein, HumanProduct Specification Species Human Antigen Parvalbumin Synonyms PVALB, D22S749 Accession P20472 Amino Acid Sequence Met1 Ser110, with N terminal 8*His HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Expression System E. coli Molecular Weight 16kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Antigen Parvalbumin
Synonyms PVALB, D22S749
Accession P20472
Amino Acid Sequence

Met1-Ser110, with N-terminal 8*His HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Expression System E.coli
Molecular Weight 16kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Virchows Arch. 2021 Apr;478(4):785-791. Epub 2020 Jun 10.

Background

Parvalbumin is a cytosolic calcium-binding protein expressed in the distal convoluted tubule of the renal nephron that is structurally and functionally similar to calmodulin and troponin C. Among epithelial renal tumors, the reactivity for parvalbumin is observed in chromophobe renal cell carcinomas and frequently in oncocytomas. This protein is thought to be involved in muscle relaxation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23338618759

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Chelsie
West Palm Beach, US
★★★★★ 5
Best sunscreen ever!!!
This is the BEST SUNCREEN. It’s all we use-and I know, I know it’s expensive (standard is $30 a bottle) BUT it does go on sale quite often for like $20 ish which is what competitors run for and this is WAY cleaner. It’s made of a lot of organic ingredients and this one smells summery but they have unscented options too-that’s normally what I get! You can get spf 30 or 50 and they both work so well, never been burned wearing it. It’s a fine spray that goes on clear and dries quick-no white cast, no rubbing in. We live in a hot state that is sunny a lot of the year so we need a good sunscreen year round and this ticks all my boxes. This is the best product coola offers!! My entire family uses it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
P
Verified Purchase
Patricia G. Trujillo
Carnegie, US
★★★★★ 5
Returning customer! :-)
Size: 2 Fl Oz (Pack of 1)
I love this product. The size is perfect, it smells amazing, and my skin has no reaction to it whatsoever (aside from what it’s supposed to do). So just a little background, my mother is Caucasian- my father is African American. I can either get a sun burn or get super tan- all depends on what products I use while under the sun. In the past, low quality products have given me a sunburn over a period of long sun exposure. Contrary to that, high quality products require me to apply less and will prevent me from sunburns. I do have to reapply, depending how much sun exposure I am getting. I originally purchased this product for a week long trip to Mexico with my boyfriend. I only bought 2 bottles- and we spent A LOT of time on the beach/ getting sun. We both used the sunscreen and STILL HAD LEFTOVERS after our trip (half a bottle still full). In addition, neither of us got sunburns- he got a nice sun kissed glow and I got a tan! It is TSA carry-on approved, very lightweight, and easy to use. I would recommend this product to anyone who asks! 10/10 will repurchase again :-)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2024
K
Verified Purchase
Kindle Customer
Fort Morgan, US
★★★★★ 5
Works & smells great!
Size: 6 Fl Oz (Pack of 1)
Works & smells great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
L
Verified Purchase
lauren bensley
New York, US
★★★★★ 5
Great smell
Size: 2 Fl Oz (Pack of 1)
Smells amazing, and goes on clear
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
M
Verified Purchase
Matthew Shesko
Louisville, US
★★★★★ 5
“Holy Sun Protection, Batman! This Stuff Works!” 🦇🦸‍♂️
Size: 6 Fl Oz (Pack of 1)
The COOLA Organic Sunscreen SPF 50 Sunblock is the real deal. It goes on smooth, absorbs quickly, and doesn’t leave behind that greasy, chalky layer most sunscreens do. I put it to the test during a full day outdoors, and it held strong—no burns, no irritation, just solid protection. What makes it even better is the formula: not overloaded with harsh chemicals, but still highly effective. It feels more like skincare than sunscreen, which makes reapplying far less of a chore. If Batman and Robin swapped their capes for beach towels, this would be the sunblock in their utility belts—powerful protection, clean ingredients, and a formula that actually works when the heat is on. 🦇☀️ Would you like me to also create short funny one-liner summaries for each review (like quick taglines), so you have both the full review and a quick punchy line to use?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 19, 2025

recommand products