EPHB2 Protein
SKU: 50848046917

EPHB2 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB2 ProteinProduct Specification Species Human Accession P29323 Amino Acid Sequence K580 V987(end)

Product Specification


Species Human
Accession P29323
Amino Acid Sequence

K580-V987(end)

KLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

Expression System Baculovirus-InsectCells
Molecular Weight 72.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50848046917

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1596 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Fox Banry
Los Angeles, US
★★★★★ 4
Great little razor!
Good product! It’s pretty easy to use, it has some heft to it, the blades are sharp, can’t complain especially for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
E
Verified Purchase
Emily Polonkiewicz
Fort Morgan, US
★★★★★ 5
Zomchi Razor for women
Size: 1 Count (Pack of 1), Color: Rose Gold Razor with Stand
Shaves great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
C
Verified Purchase
Cole Panzer
Alexandria, US
★★★★★ 5
A Quality All-Purpose/Beginner's Razor
Size: 1 Count (Pack of 1), Color: Black Razor
These Zomchi razors tend to have pretty good ratings, but a lot of the reviews and interest in them is from women. As someone who has been shaving with a safety razor for many years now, it's awesome to see women getting into safety razors, but girls shave differently from us guys so I wanted to write a review as a guy. *I will say it bluntly right here, if you are a guy or girl in the market for a safety razor, or are on the fence about trying one, buy this Zomchi razor right now. You won't regret it, and neither will your wallet. This razor is great value for money. Beautiful design with nice machining. Construction is very sturdy and even the threads that screw into the head into are top quality. On top of that, the razor has a black coating that will prevent rust later down the road and protect the longevity of the razor. Shaving my face, this razor gave me a really smooth, close, quick shave with a feather brand blade. I wasn't having to come back and make extra passes. It cut sideburns easily and got the difficult areas other razors tended to nick. If you try the Zomchi blades it comes with and you don't like them, there are so many other brands available with different characteristics. With the right blade this razor will be amazing for everyone. -Long story short, if you are looking for a quality razor at an affordable price that simply gets the job done, this is the razor for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2022
A
Verified Purchase
Amy M
Lake Worth, US
★★★★★ 5
Beautifully made.
Size: 1 Count (Pack of 1), Color: Fern Green Razor with Stand
If you’re trying to decide, just get this item. It’s sturdy, the color is gorgeous and it’s easy to load the blade. It does come with extras. You can also order large quantities from the company and they have a blade disposal can as well. Such a great design.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
A
Verified Purchase
Ariel Y.
Battle Creek, US
★★★★★ 3
Quality, but OUCH!!!
Size: 1 Count (Pack of 1), Color: Rose Gold Razor with Stand
Major learning curve, cut the crap out of myself using it, but it seems like it’s made out of quality materials.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products