EPHB3 Protein
SKU: 89128272970

EPHB3 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB3 ProteinProduct Specification Species Human Synonyms ETK2, HEK2, TYRO6 Accession P54753 Amino Acid Sequence K596 V998(end)

Product Specification


Species Human
Synonyms ETK2, HEK2, TYRO6
Accession P54753
Amino Acid Sequence

K596-V998(end)

KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, 0.1mM PMSF, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89128272970

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1573 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazing Sally
Louisville, US
★★★★★ 5
so far so good
I was surprised at this pair of pillow cases only because the material seemed impossible to be cooling - it's that weird polyester blend. So far I have not awoken feeling sweaty around my face and scalp. I don't recall what I originally paid but I think it is great value for money! If you are sensitive to out of the box smell, I washed mine first and it didn't impede on the efficacy of the cooling!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
D
Verified Purchase
Devin Hill
Grantham, US
★★★★★ 5
It’s like sleeping on a beach in San Vito lo Capo
Italian voice: I’m a big meaty fella so I put off a lot of heat ya hear. These pillow cases have changed my life. One moment they’re hot and the next you flip them and you’re blasted with a blast of ice cool what it feels like to chew 5 gum feeling capeesh. I would reccomend these pillow cases to even my grandma. If ya wanta get a rest so good that it feels like ya been sleeping with the fishes get these pillow cases, they’re the real deal. Then stop at Pauline’s joint and grab a slice of pizza say Vinnie sent ya. Anyways I gotta go my wife’s cooking up a mean lasgna and we’re gonna watch the dodgers. Let me know how these treat ya I guarantee they will change your life. Vinnie out
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 4
Soft "cooling" case.
Yes it is very cool when you lay on it. It doesn't stay cold though. Within a minute or 2 to whatever your temp is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
C
Verified Purchase
CountryGal
Houston, US
★★★★★ 5
Great for hair and skin. Great buy.
These pillow cases are great for my hair and skin. They look good, hold up well in the washer and dryer, and the price is great. They are cooling. Of course I wish they could be more cooling, but honestly I'm not sure that's even possible. Great pillow cases. Already bought more for other heads. Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
M
Verified Purchase
Melissa
Port Orchard, US
★★★★★ 1
Hot hot hot. Side sleepers will hate it
At first touch, these are the coldest pillowcases I own … but only for seconds. Once you actually lay on them, within seconds they adjust to your body temp, the heat feels trapped, my head begins to feel hotter than before I laid down - which has in turn caused me loathe these pillow cases. I hate that I have missed the return window. Would never buy again, would never recommend. My satin ones aren’t even this hot! I gave them the good ole 30-day try. Side sleepers - if you are like me and sleep on your side with arm tucked under pillow - flipping this pillow over in hopes of a cold side - forget it, it’s already hot from your arm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2025

recommand products