SKU: 76385581102

FKBP12 His Tag Protein, Human

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FKBP12 His Tag Protein, HumanProduct Specification Species Human Synonyms FKBP 12, FKBP 1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE Accession P62942 Amino Acid Sequence Met1 Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH Expression System E. coli Molecular Weight 13kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE
Accession P62942
Amino Acid Sequence

Met1-Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH

Expression System E.coli
Molecular Weight

13kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44.

Background

FKBP12 associates with several large protein complexes, including the multi-drug resistance pump and the ryanodine, inositol trisphosphate (IP3)and the type I TGF-β receptor. FKBP12 was originally identifed as a FK506 binding protein. FK506 is a clinically used immunosuppressant derived from Streptomyces tsukubaensis. The FK506–FKBP12 binary complex inhibits the protein phosphatase calcineurin, thereby preventing T lymphocytes from producing interleukin-2 in mammals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76385581102

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lee
West Palm Beach, US
★★★★★ 5
Great balls of fun!
Size: Large, Color: Ball-Red
One of the best toys that was ever made! My wife likes to put little treats in there and I'll bat the ball around. The room gives their hours of entertainment. She puts little things like hands of corn i
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 3
Choking hazard from Internal Pieces if Ball
Size: Large, Color: Ball-Blue
The Ball is Very Tough. However, the inside Parts Broke and Fall out and can be Choking Hazard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
J
Verified Purchase
Jennifer Cobb
Birmingham, US
★★★★★ 5
Great for chewers!
Size: Large, Color: Ball-Blue
We have a super high energy one year old pup who destroys practically every toy she gets. This one is excellent! It makes a fun but not annoying sound and she hasn’t been able to destroy it yet. The test hole is a fun addition to keep her busy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025
M
Verified Purchase
Michelle S.
Draper, US
★★★★★ 5
Very sturdy toy for aggressive chewers
Size: Large, Color: Bone-Blue
My 80-pound American Bully loves this toy. It is very sturdy. Good price. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 1
My Dog Loved It—Until It Stopped Working
Size: Large, Color: Ball-Red
I purchased this treat-dispensing dog toy for my German Shepherd, and for the first couple of days it worked exactly as advertised. When rolled or tossed, it made an engaging sound that immediately caught my dog’s attention and encouraged him to interact with the toy to get the treats out. He absolutely loved it. Unfortunately, after only a few days, the sound feature stopped working. Then it mysteriously started working again for a short period, so I thought the issue had resolved itself. However, it has now stopped completely. No matter how much I shake, roll, or toss the toy, it no longer makes any sound. I went out of town and didn’t realize the return window had passed while I was gone. By the time I returned, the return deadline had already expired, which was disappointing because I would have returned it when the problem first appeared. Based on my experience, I cannot recommend purchasing this toy. While many of the reviews seem positive, perhaps I received a defective unit. It’s disappointing that it stopped functioning properly after barely a month of use. That said, my dog genuinely enjoyed it when it was working, and I would appreciate it if the manufacturer would stand behind their product and offer a replacement as a courtesy. I would be happy to return the defective toy. If a replacement performed as intended, I would gladly reconsider my opinion. For now, however, I am very disappointed with the functionality and reliability of this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products