SKU: 78000618301

TGFBR2 Fc Chimera Protein, Human

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession P37173 Amino Acid Sequence Thr23 Asp159, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession P37173
Amino Acid Sequence

Thr23-Asp159, with C-terminal Human IgG1 Fc TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78000618301

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Loren Flores Morales
Fort Morgan, US
★★★★★ 5
Get this if you draw, write, play touch games
Model: iPad Pro 11,iPad Air 5th/4th
The quality of the screen protector is great, easy to put on without the video. i love how it really feels like writing on paper with my pen especially drawing. I will definitely be buying more for myself,mother and siblings. It’s a good fit for my iPad Air 4th gen and a bang for the buck
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
Jorge L.
Omaha, US
★★★★★ 4
Good but Installation was a Bit Iffy
Model: iPad A16 11th/10th/Air 11
90% of the time I use my iPad for school. Originally, I used just a regular screen protector, but it would get dirty with smudges and imprints from my Apple Pencil, and there would be a lot of glare since I'm in a classroom most of the time, which would make it awkward to see what I was writing at times. Plus, the screen protector was too smooth so it would actually be difficult to write legibly. This product makes it a lot easier to write smoother on the iPad. I only just installed it, so I can't say much on the smear protection yet, but I can already see the reduction in glare as well. For $8, getting a pack of two of these with an install kit is a very nice deal imo. My only issue was the installation process, which could've been as much my own fault tbh, but I felt like I aligned the screen protector pretty well with the sticker, however the first time I tried installing it it was way off the center (maybe my case got in the way?). The biggest issue was using the squeegee to pop air bubbles, and this is something they don't mention in neither their instruction guide nor video, but you're supposed to used the velvet red side, not the naked white side: using the white side actually takes the grit off the protector, which is obviously something you don't want on a product that relies on it. Thankfully I have another one in reserve in case this one wears off sooner than expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2025
B
Verified Purchase
Breanna
Louisville, US
★★★★★ 5
Perfect Paperlike substitute
Model: iPad Air/Pro 13
I’ve been using this screen for roughly two months now and I can say it was so worth it, it is rough on plastic nibs! I am going to order some heavier duty ones and see how it fairs! It works just fine ON TOP of a screen protector isn’t that great! I wanted something like paper like but didn’t want to pay that expensive price for something I wasn’t sure I was going to like. This one does the trick and gives me just enough resistance to feel more in control of my pen! It fits well just make sure to know the size if your screen I had to modify where the camera indent was but it cut just fine and looks great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
K
Verified Purchase
Kasey
Massapequa, US
★★★★★ 5
Wow! So cheap and really high quality!
Model: iPad Air/Pro 13
Very nice texture, affordable, durable, easy to mount. No longer get tons of grease marks from my hands, the glare is reduced, it fits the screen perfectly, there’s no tint to the color so it doesn’t distort the image. Great product for a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
D
Verified Purchase
Dylan Moyer
Lake Worth, US
★★★★★ 5
Feels like paper and makes writing fun!
Model: iPad A16 11th/10th/Air 11
I was hesitant to start using my iPad for class because I HATED how my Apple Pencil sounded hitting the screen while I was writing. This product has completely changed my mind and now I use it almost daily! I love the feel of this screen and it has lasted all semester long. It was a little tricky getting the screen on just right, and I had to use both because the first time I had a bunch of air bubbles, but the second time was perfect! I think you would probably want to get a new screen every year to ensure it still has that paper-like feel, but I think that’s totally reasonable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products