SKU: 1069790023

TGFBR2 Fc Chimera Protein, Mouse

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, MouseProduct Specification Species Mouse Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession Q62312 1 Amino Acid Sequence Ile24 Asp184, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession Q62312-1
Amino Acid Sequence

Ile24-Asp184, with C-terminal Human IgG1 Fc IPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1069790023

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Teresa Cloninger
San Leandro, US
★★★★★ 5
Home bar cart
Color: Brown(24.8"w)
My son loves his gift. Fits perfectly in his den, versatile shelves, the perfect size. It’s a Quality bar cart that was easy to assemble and looks beautiful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
J
Verified Purchase
Joy
Pawtucket, US
★★★★★ 5
Nice small bar cart
Color: Brown(17"w), Color: Brown(17"w)
We have a bar area but it’s downstairs and we are usually upstairs so it’s not convenient. I wanted a little cart to hold a few items but not be in the way. After looking all over the Internet I found this one for a good price. I liked the ability to remove the top so we can bring just that into the kitchen or living room and it looks nice. I had to put it together and it wasn’t too difficult, took about 30 min, HOWEVER I used a ratcheting screwdriver with an Allen wrench attachment or else it would have taken a lot longer! (It does come with the little Allen wrench included so you don’t have to purchase any tools.) All the parts were labeled well and included a couple extra screws. I tightened it up good and it’s sturdy. It doesn’t take up a lot of space. If you just need a small cart this will work! PS you can opt to leave off the parts that hold the wine glass if you don’t need them/ or want more space on that middle shelf
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
P
Verified Purchase
Pedro
Bozeman, US
★★★★★ 5
Wife’s wish comes true!
Color: Brown(24.8"w), Color: Brown(24.8"w)
Great product, at a great price, and fast delivery! I ordered these gifts (the cart, Bartesian Bartesian Premium Cocktail and Margarita Machine, Dust Cover, Margaritas Dipping Dishes, and individual drinks cups) as a Christmas gift for my wife! She always wanted to have a “Drinks and Wine Cart”…and she loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
A
Verified Purchase
aryane o's bea
Chelsea, US
★★★★★ 4
Ninjavan delivery not recommended
Color: Brown(24.8"w)
Bar cart came with instructions that were easy to follow for assembly. Size and height were as expected. The real problem was the delivery. Ninjavan was not able to deliver on time and kept saying that the wrong address was provided. Item was supposed to arrive on Dec 15 however, we reached out to Amazon about the problem and they sent a new item which arrived December 30 using a different courier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
D
Verified Purchase
Dianna L Purves
Birmingham, US
★★★★★ 5
Sturdy space saving cute little wine/alcohol cart on wheels
Color: Brown(24.8"w), Color: Brown(24.8"w)
Sturdy space saving cute little wine/alcohol cart on wheels. Very well designed. Took a while to put together because there were so many pieces but it was easy and it was worth it. High quality. Bought it on Black Friday and got an amazing deal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025

recommand products